ACAT2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ACAT2 antibody: synthetic peptide directed towards the middle region of human ACAT2. Synthetic peptide located within the following region: SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	41 kDa
Gene Name	acetyl-CoA acetyltransferase 2
Database Link	NP_005882 Entrez Gene 39 Human UniProt ID Q9BWD1
Background	Acetyl-Coenzyme A acetyltransferase 2 is an enzyme involved in lipid metabolism. Reported patients with ACAT2 deficiency have shown severe mental retardation and hypotonus. The ACAT2 gene shows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation.
Synonyms	acetoacetyl Coenzyme A thiolase; acetyl-Coenzyme A acetyltransferase 2; cytosolic acetoacetyl-CoA thiolase; OTTHUMP00000017527
Note	Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 92%; Horse: 92%; Mouse: 92%; Rabbit: 92%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Butanoate metabolism, Fatty acid metabolism, Lysine degradation, Metabolic pathways, Propanoate metabolism, Pyruvate metabolism, Synthesis and degradation of ketone bodies, Terpenoid backbone biosynthesis, Tryptophan metabolism, Valine, leucine and isoleucine degradation

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.