AGFG2 Rabbit Polyclonal Antibody
CAT#: TA332045
Rabbit Polyclonal Anti-AGFG2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-AGFG2 Antibody is: synthetic peptide directed towards the N-terminal region of Human AGFG2. Synthetic peptide located within the following region: NEVCRKIWLGLFDARTSLVPDSRDPQKVKEFLQEKYEKKRWYVPPDQVKG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 53 kDa |
Gene Name | ArfGAP with FG repeats 2 |
Database Link | |
Background | This gene is a member of the HIV-1 Rev binding protein (HRB) family and encodes a protein with one Arf-GAP zinc finger domain, several phe-gly (FG) motifs, and four asn-pro-phe (NPF) motifs. This protein interacts with Eps15 homology (EH) domains and plays a role in the Rev export pathway, which mediates the nucleocytoplasmic transfer of proteins and RNAs. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. The 3' UTR of this gene contains an insulin receptor substrate 3-like pseudogene. |
Synonyms | HRBL; RABR |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |