DNA polymerase mu (POLM) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-POLM antibody: synthetic peptide directed towards the middle region of human POLM. Synthetic peptide located within the following region: LRRFSRKEKGLWLNSHGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	55 kDa
Gene Name	polymerase (DNA) mu
Database Link	NP_037416 Entrez Gene 27434 Human UniProt ID Q9NP87
Background	POLM seems to act as an Ig mutase which is responsible for immunoglobulin (Ig) gene hypermutation.
Synonyms	Pol Mu; Tdt-N
Note	Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Rat: 93%; Guinea pig: 93%; Dog: 92%; Mouse: 86%; Rabbit: 86%; Bovine: 79%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Non-homologous end-joining

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.