Neuraminidase (NEU1) Rabbit Polyclonal Antibody
CNY 4,381.00
Cited in 4 publications. |
CNY 300.00
CNY 1,430.00
CNY 9,998.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-NEU1 antibody: synthetic peptide directed towards the middle region of human NEU1. Synthetic peptide located within the following region: VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 40 kDa |
Gene Name | neuraminidase 1 (lysosomal sialidase) |
Database Link | |
Background | NEU1 is a lysosomal enzyme, which cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. In the lysosome, this enzyme is part of a heterotrimeric complex together with beta-galactosidase and cathepsin A. Mutations in NEU1 gene can lead to sialidosis.The protein encoded by this gene encodes the lysosomal enzyme, which cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. In the lysosome, this enzyme is part of a heterotrimeric complex together with beta-galactosidase and cathepsin A (the latter also referred to as 'protective protein'). Mutations in this gene can lead to sialidosis. |
Synonyms | NANH; NEU; SIAL1 |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Horse: 93%; Pig: 86%; Guinea pig: 86%; Dog: 79% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Lysosome, Other glycan degradation, Sphingolipid metabolism |
Citations (4)
The use of this Antibodies has been cited in the following citations: |
---|
High-fat diet-induced adipose tissue and liver inflammation and steatosis in mice are reduced by inhibiting sialidases
,Pilling, D;Karhadkar, TR;Gomer, RH;,
Am J Pathol
,PubMed ID 33039353
[NEU1]
|
Therapeutic Effect of Neuraminidase-1–Selective Inhibition in Mouse Models of Bleomycin-Induced Pulmonary Inflammation and Fibrosis
,null,
The Journal of Pharmacology and Experimental Therapeutics
,PubMed ID 33139318
[NEU1]
|
Attenuated pulmonary fibrosis in sialidase-3 knockout (Neu3−/−) mice
,null,
American Journal of Physiology - Lung Cellular and Molecular Physiology
,PubMed ID 31617733
[NEU1]
|
Sialidase inhibitors attenuate pulmonary fibrosis in a mouse model
,null,
Scientific Reports
,PubMed ID 29118338
[NEU1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |
其它Neuraminidase产品