GLUD1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human, Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GLUD1 antibody: synthetic peptide directed towards the N terminal of human GLUD1. Synthetic peptide located within the following region: AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	56 kDa
Gene Name	glutamate dehydrogenase 1
Database Link	NP_005262 Entrez Gene 24399 RatEntrez Gene 2746 Human UniProt ID P00367
Background	This gene encodes glutamate dehydrogenase protein; a mitochondrial matrix enzyme that catalyzes the oxidative deamination of glutamate to alpha-ketoglutarate and ammonia. This enzyme has an important role in regulating amino acid induced insulin secretion and activating mutations in this gene are a common cause of congenital hyperinsulinism. This enzyme is allosterically activated by ADP and inhibited by GTP and ATP. The related glutamate dehydrogenase 2 gene on the human X-chromosome originated from this gene via retrotransposition and encodes a soluble form of glutamate dehydrogenase. Multiple pseudogenes of this gene are present in humans. [provided by RefSeq, Sep 2009]
Synonyms	GDH; GDH1; GLUD
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 86%; Guinea pig: 86%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Alanine, aspartate and glutamate metabolism, Arginine and proline metabolism, D-Glutamine and D-glutamate metabolism, Metabolic pathways, Nitrogen metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.