FUBP1 Rabbit Polyclonal Antibody
CAT#: TA339086
Rabbit Polyclonal Anti-FUBP1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,200.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-FUBP1 antibody: synthetic peptide directed towards the middle region of human FUBP1. Synthetic peptide located within the following region: YYAHYYQQQAQPPPAAPAGAPTTTQTNGQGDQQNPAPAGQVDYTKAWEEY |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 67 kDa |
Gene Name | far upstream element binding protein 1 |
Database Link | |
Background | This gene encodes a ssDNA binding protein that activates the far upstream element (FUSE) of c-myc and stimulates expression of c-myc in undifferentiated cells. Regulation of FUSE by FUBP occurs through single-strand binding of FUBP to the non-coding strand. This protein has been shown to function as an ATP-dependent DNA helicase. [provided by RefSeq, Jul 2008] |
Synonyms | FBP; FUBP; hDH V |
Note | Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%; Mouse: 92% |
Reference Data | |
Protein Families | Stem cell - Pluripotency, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |