GCOM1 Rabbit Polyclonal Antibody

CAT#: TA339965

Rabbit Polyclonal Anti-Gcom1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Transient overexpression lysate of GRINL1A complex locus (GCOM1), transcript variant 1
    • 100 ug

CNY 4,840.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-Gcom1 antibody: synthetic peptide directed towards the middle region of human Gcom1. Synthetic peptide located within the following region: VAQVENQLLKMKVESSQEANAEVMREMTKKLYSQYEEKLQEEQRKHSAEK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 52 kDa
Gene Name GRINL1A complex locus 1
Background This gene (Gcom1) is part of a complex transcript unit that includes the gene for glutamate receptor, ionotropic, N-methyl D-aspartate-like 1A (GRINL1A). Transcription of this gene occurs at an upstream promoter, with two different groups of alternatively spliced variants: Gup for GRINL1A upstream transcripts and Gcom for GRINL1A combined transcripts. The GRINL1A gene uses a downstream promoter for transcription and also has multiple alternatively spliced variants. This gene (Gcom1) is part of a complex transcript unit that includes the gene for glutamate receptor, ionotropic, N-methyl D-aspartate-like 1A (GRINL1A). Transcription of this gene occurs at an upstream promoter, with two different groups of alternatively spliced variants: Gup for GRINL1A upstream transcripts and Gcom for GRINL1A combined transcripts. The GRINL1A gene uses a downstream promoter for transcription and also has multiple alternatively spliced variants.
Synonyms gcom; Gcom2; GRINL1A; MYZAP; MYZAP-POLR2M
Note Immunogen Sequence Homology: Human: 100%; Yeast: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Guinea pig: 93%; Rabbit: 86%; Horse: 85%; Bovine: 85%; Dog: 77%; Zebrafish: 75%
Reference Data
Protein Families Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...