GJA4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GJA4 antibody: synthetic peptide directed towards the middle region of human GJA4. Synthetic peptide located within the following region: QKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	gap junction protein alpha 4
Database Link	NP_002051 Entrez Gene 2701 Human UniProt ID P35212
Background	This gene encodes a member ofThe connexin gene family.The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route forThe diffusion of low molecular weight materials from cell to cell. Mutations inThis gene have been associated with atherosclerosis and a higher risk of myocardial infarction. [provided by RefSeq, Jul 2008]
Synonyms	CX37
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Dog: 93%; Sheep: 93%; Bovine: 93%; Pig: 86%; Rat: 86%; Guinea pig: 86%; Horse: 79%; Mouse: 79%
Reference Data
Protein Families	Ion Channels: Other, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.