NAGPA Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-NAGPA antibody is: synthetic peptide directed towards the N-terminal region of Human NAGPA. Synthetic peptide located within the following region: GECLGNVVSDERRVSSSGGLQNAQFGIRRDGTLVTGYLSEEEVLDTENPF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	53 kDa
Gene Name	N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase
Database Link	NP_057340 Entrez Gene 51172 Human UniProt ID Q9UK23
Background	Hydrolases are transported to lysosomes after binding to mannose 6-phosphate receptors inThe trans-Golgi network.This gene encodesThe enzyme that catalyzesThe second step inThe formation ofThe mannose 6-phosphate recognition marker on lysosomal hydrolases. Commonly known as 'uncovering enzyme' or UCE,This enzyme removes N-acetyl-D-glucosamine (GlcNAc) residues from GlcNAc-alpha-P-mannose moieties andThereby producesThe recognition marker.This reaction most likely occurs inThe trans-Golgi network.This enzyme functions as a homotetramer of two disulfide-linked homodimers. In addition to having an N-terminal signal peptide,The protein's C-terminus contains multiple signals for trafficking it between lysosomes,The plasma membrane, and trans-Golgi network. [provided by RefSeq, Jul 2008]
Synonyms	APAA; UCE
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 86%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Lysosome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.