A4GALT Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-A4GALT antibody: synthetic peptide directed towards the middle region of human A4GALT. Synthetic peptide located within the following region: RIALMWKFGGIYLDTDFIVLKNLRNLTNVLGTQSRYVLNGAFLAFERRHE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	40 kDa
Gene Name	alpha 1,4-galactosyltransferase
Database Link	NP_059132 Entrez Gene 53947 Human UniProt ID Q9NPC4
Background	The protein encoded byThis gene catalyzesThe transfer of galactose to lactosylceramide to form globotriaosylceramide, which has been identified asThe P(k) antigen ofThe P blood group system.The encoded protein, which is a type II membrane protein found inThe Golgi, is also required forThe synthesis ofThe bacterial verotoxins receptor. [provided by RefSeq, Jul 2008]
Synonyms	A4GALT1; A14GALT; Gb3S; P(k); P1; P1PK; PK
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families	Druggable Genome, Transmembrane
Protein Pathways	Glycosphingolipid biosynthesis - globo series, Metabolic pathways

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.