QPCTL Rabbit Polyclonal Antibody
CAT#: TA342033
Rabbit Polyclonal Anti-QPCTL Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-QPCTL antibody: synthetic peptide directed towards the middle region of human QPCTL. Synthetic peptide located within the following region: QLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFML |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 43 kDa |
Gene Name | glutaminyl-peptide cyclotransferase-like |
Database Link | |
Background | QPCTL is a single-pass membrane proteinPotential. It belongs toThe glutaminyl-peptide cyclotransferase family.The exact function of QPCTL remains unknown. |
Synonyms | gQC |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Rabbit: 93%; Pig: 92%; Guinea pig: 92%; Horse: 86% |
Reference Data | |
Protein Families | Protease, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |