QPCTL Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-QPCTL antibody: synthetic peptide directed towards the middle region of human QPCTL. Synthetic peptide located within the following region: QLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFML
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	glutaminyl-peptide cyclotransferase-like
Database Link	NP_060129 Entrez Gene 54814 Human UniProt ID Q9NXS2
Background	QPCTL is a single-pass membrane proteinPotential. It belongs toThe glutaminyl-peptide cyclotransferase family.The exact function of QPCTL remains unknown.
Synonyms	gQC
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Rabbit: 93%; Pig: 92%; Guinea pig: 92%; Horse: 86%
Reference Data
Protein Families	Protease, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.