SMPD4 Rabbit Polyclonal Antibody
CAT#: TA342050
Rabbit Polyclonal Anti-Smpd4 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 4,840.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Rat |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Smpd4 antibody is: synthetic peptide directed towards the middle region of Rat Smpd4. Synthetic peptide located within the following region: LHSPAQPSLQALHAYQESFMPTEEHVLVVRLLLKHLHAFANSLKPDQASP |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 90 kDa |
Gene Name | sphingomyelin phosphodiesterase 4 |
Database Link | |
Background | The function ofThis protein remains unknown. |
Synonyms | NET13; NSMASE-3; NSMASE3 |
Note | Immunogen Sequence Homology: Dog: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 93%; Rabbit: 93%; Guinea pig: 93%; Horse: 86%; Bovine: 86% |
Reference Data | |
Protein Families | Transmembrane |
Protein Pathways | Metabolic pathways, Sphingolipid metabolism |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |