ACSM3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ACSM3 antibody: synthetic peptide directed towards the C terminal of human ACSM3. Synthetic peptide located within the following region: DQEQLIKEIQEHVKKTTAPYKYPRKVEFIQELPKTISGKTKRNELRKKEW
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	66 kDa
Gene Name	acyl-CoA synthetase medium-chain family member 3
Database Link	NP_005613 Entrez Gene 6296 Human UniProt ID Q53FZ2
Background	Q53FZ2 has medium-chain fatty acid:CoA ligase activity with broad substrate specificity (in vitro). It acts on acids from C4 to C(11) and on the corresponding 3-hydroxy- and 2,3- or 3,4-unsaturated acids (in vitro).
Synonyms	SA; SAH
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Horse: 92%; Rat: 86%; Zebrafish: 79%; Guinea pig: 79%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Butanoate metabolism, Metabolic pathways

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.