AGPAT3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-AGPAT3 antibody: synthetic peptide directed towards the middle region of human AGPAT3. Synthetic peptide located within the following region: KRKWEEDRDTVVEGLRRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	1-acylglycerol-3-phosphate O-acyltransferase 3
Database Link	NP_064517 Entrez Gene 56894 Human UniProt ID Q9NRZ7
Background	The protein encoded by this gene is an acyltransferase that converts lysophosphatidic acid into phosphatidic acid, which is the second step in the de novo phospholipid biosynthetic pathway. The encoded protein may be an integral membrane protein. Two transcript variants encoding the same protein have been found for this gene.
Synonyms	LPAAT-GAMMA1; LPAAT3
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Zebrafish: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Guinea pig: 93%; Dog: 86%; Bovine: 86%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Ether lipid metabolism, Glycerolipid metabolism, Glycerophospholipid metabolism, Metabolic pathways

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.