JMJD7-PLA2G4B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PLA2G4B antibody: synthetic peptide directed towards the N terminal of human PLA2G4B. Synthetic peptide located within the following region: AEAALEAVRSELREFPAAARELCVPLAVPYLDKPPTPLHFYRDWVCPNRP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	114 kDa
Gene Name	JMJD7-PLA2G4B readthrough
Database Link	NP_005081 Entrez Gene 8681 Human UniProt ID P0C869
Background	PLA2G4B gene transcribes naturally-occurring mRNAs that are co-transcribed products of the neighboring JMJD7 and PLA2G4B genes. Incompletely processed read-through transcripts from these two loci are abundantly expressed in most tissues, but the function of the predicted protein product has not yet been determined. Alternative splicing of this gene results in different transcript variants, some of which are candidates for nonsense-mediated decay (NMD).The LOC100137047-PLA2G4B mRNAs are naturally occurring co-transcribed products of the neighboring LOC100137047 and PLA2G4B genes. Incompletely processed read-through transcripts from these two loci are abundantly expressed in most tissues, but the function of the predicted protein product has not yet been determined. Alternative splicing of this gene results in different transcript variants, some of which are candidates for nonsense-mediated decay (NMD).
Synonyms	cPLA2-beta; HsT16992
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Rat: 90%; Pig: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%; Mouse: 79%
Reference Data
Protein Pathways	alpha-Linolenic acid metabolism, Arachidonic acid metabolism, Ether lipid metabolism, Fc epsilon RI signaling pathway, Glycerophospholipid metabolism, GnRH signaling pathway, Linoleic acid metabolism, Long-term depression, MAPK signaling pathway, Metabolic pathways, Vascular smooth muscle contraction, VEGF signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.