RAB22A Rabbit Polyclonal Antibody
CAT#: TA344771
Rabbit Polyclonal Anti-RAB22A Antibody - middle region
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB |
Reactivity | Human, Murine |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RAB22A antibody: synthetic peptide directed towards the middle region of human RAB22A. Synthetic peptide located within the following region: IFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 22 kDa |
Gene Name | RAB22A, member RAS oncogene family |
Database Link | |
Background | The protein encoded by this gene is a member of the RAB family of small GTPases. The GTP-bound form of the encoded protein has been shown to interact with early-endosomal antigen 1, and may be involved in the trafficking of and interaction between endosom |
Synonyms | MGC16770 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 93% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Endocytosis |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |