PIGK Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PIGK antibody: synthetic peptide directed towards the N terminal of human PIGK. Synthetic peptide located within the following region: SVYRSVKRLGIPDSHIVLMLADDMACNPRNPKPATVFSHKNMELNVYGDD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	phosphatidylinositol glycan anchor biosynthesis class K
Database Link	NP_005473 Entrez Gene 10026 Human UniProt ID Q92643
Background	PIGK is a member of the cysteine protease family C13 that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. PIGK is a member of the multisubunit enzyme, GPI transamidase and is thought to be its enzymatic component. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins. This gene encodes a member of the cysteine protease family C13 that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This protein is a member of the multisubunit enzyme, GPI transamidase and is thought to be its enzymatic component. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms	GPI8
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%
Reference Data
Protein Families	Druggable Genome, Protease, Transmembrane
Protein Pathways	Glycosylphosphatidylinositol(GPI)-anchor biosynthesis, Metabolic pathways

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.