Steroid sulfatase (STS) Rabbit Polyclonal Antibody
CNY 5,200.00
Cited in 1 publication. |
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-STS antibody: synthetic peptide directed towards the middle region of human STS. Synthetic peptide located within the following region: EPTSNMDIFPTVAKLAGAPLPEDRIIDGRDLMPLLEGKSQRSDHEFLFHY |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 63 kDa |
Gene Name | steroid sulfatase (microsomal), isozyme S |
Database Link | |
Background | STS catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in its gene are known to cause X-linked ichthyosis The protein encoded by this gene catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The encoded protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in this gene are known to cause X-linked ichthyosis (XLI). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Synonyms | ARSC; ARSC1; ASC; ES; SSDD; XLI |
Note | Immunogen Sequence Homology: Human: 100%; Horse: 93%; Pig: 92%; Bovine: 90%; Zebrafish: 89%; Guinea pig: 86%; Dog: 80%; Mouse: 77%; Rabbit: 77% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Androgen and estrogen metabolism |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
Arylsulfatase B mediates the sulfonation-transport interplay in human embryonic kidney (HEK) 293 cells overexpressing sulfotransferase 1A3
,Zhao, M;Wang, S;Li, F;Dong, D;Wu, B;,
Drug Metab. Dispos.
,PubMed ID 27325375
[STS]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |
其它Steroid sulfatase产品