AGXT2 Rabbit Polyclonal Antibody
CAT#: TA346847
Rabbit Polyclonal Anti-AGXT2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 4,840.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-AGXT2 antibody: synthetic peptide directed towards the N terminal of human AGXT2. Synthetic peptide located within the following region: TSVTKLSLHTKPRMPPCDFMPERYQSLGYNRVLEIHKEHLSPVVTAYFQK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 52 kDa |
Gene Name | alanine--glyoxylate aminotransferase 2 |
Database Link | |
Background | The protein encoded by this gene is a class III pyridoxal-phosphate-dependent mitochondrial aminotransferase. It catalyzes the conversion of glyoxylate to glycine using L-alanine as the amino donor. [provided by RefSeq, Dec 2008] |
Synonyms | AGT2; DAIBAT |
Note | Immunogen Sequence Homology: Human: 100%; Bovine: 86%; Dog: 79%; Rat: 79%; Horse: 79%; Rabbit: 79%; Mouse: 77% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Alanine, aspartate and glutamate metabolism |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |