Ccl19 (NM_011888) Mouse Tagged ORF Clone
CAT#: MR222280
- TrueORF®
Ccl19 (Myc-DDK-tagged) - Mouse chemokine (C-C motif) ligand 19 (Ccl19)
ORF Plasmid: tGFP
Lentiviral Particles: DDK
"NM_011888" in other vectors (5)
Need custom modification / cloning service?
Get a free quote
CNY 1,800.00
CNY 4,180.00
CNY 300.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | CKb11; ELC; exodus-3; MIP3B; Scya19 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR222280 representing NM_011888
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCCCCCGTGTGACCCCACTCCTGGCCTTCAGCCTGCTGGTTCTCTGGACCTTCCCAGCCCCAACTC TGGGGGGTGCTAATGATGCGGAAGACTGCTGCCTGTCTGTGACCCAGCGCCCCATCCCTGGGAACATCGT GAAAGCCTTCCGCTACCTTCTTAATGAAGATGGCTGCAGGGTGCCTGCTGTTGTGTTCACCACACTAAGG GGCTATCAGCTCTGTGCACCTCCAGACCAGCCCTGGGTGGATCGCATCATCCGAAGACTGAAGAAGTCTT CTGCCAAGAACAAAGGCAACAGCACCAGAAGGAGCCCTGTGTCT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR222280 representing NM_011888
Red=Cloning site Green=Tags(s) MAPRVTPLLAFSLLVLWTFPAPTLGGANDAEDCCLSVTQRPIPGNIVKAFRYLLNEDGCRVPAVVFTTLR GYQLCAPPDQPWVDRIIRRLKKSSAKNKGNSTRRSPVS myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_011888 |
ORF Size | 324 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_011888.3 |
RefSeq Size | 720 bp |
RefSeq ORF | 327 bp |
Locus ID | 24047 |
UniProt ID | O70460 |
MW | 12.4 kDa |
Gene Summary | Strongly chemotactic for naive (L-selectinhi) CD4 T-cells and for CD8 T-cells and weakly attractive for resting B-cells and memory (L-selectinlo) CD4 T-cells. May play a role in promoting encounters between recirculating T-cells and dendritic cells and in the migration of activated B-cells into the T-zone of secondary lymphoid tissues. Binds to chemokine receptor CCR7. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC204795 | Ccl19 (untagged) - Mouse chemokine (C-C motif) ligand 19 (Ccl19), (10ug) |
CNY 1,800.00 |
|
MG222280 | Ccl19 (tGFP-tagged) - Mouse chemokine (C-C motif) ligand 19 (Ccl19), (10ug) |
CNY 3,400.00 |
|
MR222280L1 | Lenti ORF clone of Ccl19 (Myc-DDK-tagged) - Mouse chemokine (C-C motif) ligand 19 (Ccl19) |
CNY 4,200.00 |
|
MR222280L3 | Lenti ORF clone of Ccl19 (Myc-DDK-tagged) - Mouse chemokine (C-C motif) ligand 19 (Ccl19) |
CNY 5,890.00 |
|
MR222280L4 | Lenti ORF clone of Ccl19 (mGFP-tagged) - Mouse chemokine (C-C motif) ligand 19 (Ccl19) |
CNY 4,200.00 |