Interferon gamma (IFNG) (NM_000619) Human Tagged ORF Clone
CAT#: RC209993
IFNG (Myc-DDK-tagged)-Human interferon, gamma (IFNG)
ORF Plasmid: tGFP
"NM_000619" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,800.00
CNY 3,705.00
Cited in 3 publications. |
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | IFG; IFI; IMD69 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC209993 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAAATATACAAGTTATATCTTGGCTTTTCAGCTCTGCATCGTTTTGGGTTCTCTTGGCTGTTACTGCC AGGACCCATATGTAAAAGAAGCAGAAAACCTTAAGAAATATTTTAATGCAGGTCATTCAGATGTAGCGGA TAATGGAACTCTTTTCTTAGGCATTTTGAAGAATTGGAAAGAGGAGAGTGACAGAAAAATAATGCAGAGC CAAATTGTCTCCTTTTACTTCAAACTTTTTAAAAACTTTAAAGATGACCAGAGCATCCAAAAGAGTGTGG AGACCATCAAGGAAGACATGAATGTCAAGTTTTTCAATAGCAACAAAAAGAAACGAGATGACTTCGAAAA GCTGACTAATTATTCGGTAACTGACTTGAATGTCCAACGCAAAGCAATACATGAACTCATCCAAGTGATG GCTGAACTGTCGCCAGCAGCTAAAACAGGGAAGCGAAAAAGGAGTCAGATGCTGTTTCGAGGTCGAAGAG CATCCCAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC209993 protein sequence
Red=Cloning site Green=Tags(s) MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQS QIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVM AELSPAAKTGKRKRSQMLFRGRRASQ myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_000619 |
ORF Size | 498 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_000619.3 |
RefSeq Size | 1240 bp |
RefSeq ORF | 501 bp |
Locus ID | 3458 |
UniProt ID | P01579 |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Allograft rejection, Cytokine-cytokine receptor interaction, Graft-versus-host disease, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Proteasome, Regulation of autophagy, Systemic lupus erythematosus, T cell receptor signaling pathway, TGF-beta signaling pathway, Type I diabetes mellitus |
MW | 19.3 kDa |
Gene Summary | This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. Mutations in this gene are associated with an increased susceptibility to viral, bacterial and parasitic infections and to several autoimmune diseases. [provided by RefSeq, Dec 2015] |
Citations (3)
The use of this cDNA Clones has been cited in the following citations: |
---|
Transient transfection of the respiratory epithelium with gamma interferon for host-directed therapy in pulmonary tuberculosis
,Bharti, R;Srivastava, A;Roy, T;Verma, K;Reddy, DS;Shafi, H;Verma, S;Raman, SK;Singh, AK;Singh, J;Ray, L;Misra, A;,
Mol Ther Nucleic Acids
,PubMed ID 33110704
[Interferon gamma]
|
Inherited human IFN- γ deficiency underlies mycobacterial disease
,null,
The Journal of Clinical Investigation
,PubMed ID 32163377
[Interferon gamma]
|
Long Interleukin-22 Binding Protein Isoform-1 Is an Intracellular Activator of the Unfolded Protein Response
,Gómez-Fernández, P;Urtasun, A;Paton, AW;Paton, JC;Borrego, F;Dersh, D;Argon, Y;Alloza, I;Vandenbroeck, K;,
Front Immunol
,PubMed ID 30619294
[Interferon gamma]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC209993L1 | Lenti ORF clone of Human interferon, gamma (IFNG), Myc-DDK-tagged |
CNY 4,200.00 |
|
RC209993L2 | Lenti ORF clone of Human interferon, gamma (IFNG), mGFP tagged |
CNY 5,890.00 |
|
RC209993L3 | Lenti ORF clone of Human interferon, gamma (IFNG), Myc-DDK-tagged |
CNY 4,200.00 |
|
RC209993L4 | Lenti ORF clone of Human interferon, gamma (IFNG), mGFP tagged |
CNY 5,890.00 |
|
RG209993 | IFNG (tGFP-tagged) - Human interferon, gamma (IFNG) |
CNY 3,400.00 |
|
SC300109 | IFNG (untagged)-Human interferon, gamma (IFNG) |
CNY 3,600.00 |
其它Interferon gamma产品