PCBP2 (NM_005016) Human Tagged ORF Clone

CAT#: RC210035

PCBP2 (Myc-DDK-tagged)-Human poly(rC) binding protein 2 (PCBP2), transcript variant 1

ORF Plasmid: DDK tGFP



  "NM_005016" in other vectors (6)

Need custom modification / cloning service?
Get a free quote

CNY 5,488.00


货期*
现货

规格
    • 10 ug

Cited in 1 publication.

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


Rabbit Polyclonal antibody to PCBP2 (poly(rC) binding protein 2)
    • 100 ul

CNY 6,281.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Synonyms hnRNP-E2; HNRNPE2; HNRPE2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC210035 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACACCGGTGTGATTGAAGGTGGATTAAATGTCACTCTCACCATCCGGCTACTTATGCATGGAAAGG
AAGTTGGCAGTATCATCGGAAAGAAAGGAGAATCAGTTAAGAAGATGCGCGAGGAGAGTGGTGCACGTAT
CAACATCTCAGAAGGGAATTGTCCTGAGAGAATTATCACTTTGGCTGGACCCACTAATGCCATCTTCAAA
GCCTTTGCTATGATCATTGACAAACTGGAAGAGGACATAAGCAGCTCTATGACCAATAGCACAGCTGCCA
GTAGACCCCCGGTCACCCTGAGGCTGGTGGTCCCTGCTAGTCAGTGTGGCTCTCTCATTGGAAAAGGTGG
ATGCAAGATCAAGGAAATACGAGAGAGTACAGGGGCTCAGGTCCAGGTGGCAGGGGATATGCTACCCAAC
TCAACTGAGCGGGCCATCACTATTGCTGGCATTCCACAATCCATCATTGAGTGTGTCAAACAGATCTGCG
TGGTCATGTTGGAGACTCTCTCCCAGTCCCCCCCGAAGGGCGTGACCATCCCGTACCGGCCCAAGCCGTC
CAGCTCTCCGGTCATCTTTGCAGGTGGTCAGGACAGGTACAGCACAGGCAGCGACAGTGCGAGCTTTCCC
CACACCACCCCGTCCATGTGCCTCAACCCTGACCTGGAGGGACCACCTCTAGAGGCCTATACCATTCAAG
GACAGTATGCCATTCCACAGCCAGATTTGACCAAGCTGCACCAGTTGGCAATGCAACAGTCTCATTTTCC
CATGACGCATGGCAACACCGGATTCAGTGGCATTGAATCCAGCTCTCCAGAGGTGAAAGGCTATTGGGCA
GGTTTGGATGCATCTGCTCAGACTACTTCTCATGAACTCACCATTCCAAACGATTTGATTGGCTGCATAA
TCGGGCGTCAAGGCGCCAAAATCAATGAGATCCGTCAGATGTCTGGGGCGCAGATCAAAATTGCGAACCC
AGTGGAAGGATCTACTGATAGGCAGGTTACCATCACTGGATCTGCTGCCAGCATTAGCCTGGCTCAATAT
CTAATCAATGTCAGGCTTTCCTCGGAGACGGGTGGCATGGGGAGCAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210035 protein sequence
Red=Cloning site Green=Tags(s)

MDTGVIEGGLNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFK
AFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPN
STERAITIAGIPQSIIECVKQICVVMLETLSQSPPKGVTIPYRPKPSSSPVIFAGGQDRYSTGSDSASFP
HTTPSMCLNPDLEGPPLEAYTIQGQYAIPQPDLTKLHQLAMQQSHFPMTHGNTGFSGIESSSPEVKGYWA
GLDASAQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSTDRQVTITGSAASISLAQY
LINVRLSSETGGMGSS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005016
ORF Size 1098 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005016.6
RefSeq Size 3187 bp
RefSeq ORF 1101 bp
Locus ID 5094
UniProt ID Q15366
Domains KH
MW 38.7 kDa
Gene Summary The protein encoded by this gene appears to be multifunctional. Along with PCBP-1 and hnRNPK, it is one of the major cellular poly(rC)-binding proteins. The encoded protein contains three K-homologous (KH) domains which may be involved in RNA binding. Together with PCBP-1, this protein also functions as a translational coactivator of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES, promoting poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This multiexon structural mRNA is thought to be retrotransposed to generate PCBP-1, an intronless gene with functions similar to that of PCBP2. This gene and PCBP-1 have paralogous genes (PCBP3 and PCBP4) which are thought to have arisen as a result of duplication events of entire genes. This gene also has two processed pseudogenes (PCBP2P1 and PCBP2P2). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2018]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)

Other Versions

Customer Reviews 
Loading...