OTUB1 (NM_017670) Human Tagged ORF Clone

CAT#: RC210648

  • TrueORF®

OTUB1 (Myc-DDK-tagged)-Human OTU domain, ubiquitin aldehyde binding 1 (OTUB1), transcript variant 1

ORF Plasmid: DDK tGFP



  "NM_017670" in other vectors (6)

Need custom modification / cloning service?
Get a free quote

CNY 3,990.00


货期*
3周

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


OTUB1 mouse monoclonal antibody, clone OTI5B8 (formerly 5B8)
    • 100 ul

CNY 1,999.00
CNY 2,700.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Synonyms HSPC263; OTB1; OTU1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC210648 representing NM_017670.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGGCGGCGGAGGAACCTCAGCAGCAGAAGCAGGAGCCGCTGGGCAGCGACTCCGAAGGTGTTAACTGT
CTGGCCTATGATGAAGCCATCATGGCTCAGCAGGACCGAATTCAGCAAGAGATTGCTGTGCAGAACCCT
CTGGTGTCAGAGCGGCTGGAGCTCTCGGTCCTATACAAGGAGTATGCTGAAGATGACAACATCTATCAA
CAGAAGATCAAGGACCTCCACAAAAAGTACTCGTACATCCGCAAGACCAGGCCTGACGGCAACTGTTTC
TATCGGGCTTTCGGATTCTCCCACTTGGAGGCACTGCTGGATGACAGCAAGGAGTTGCAGCGGTTCAAG
GCTGTGTCTGCCAAGAGCAAGGAAGACCTGGTGTCCCAGGGCTTCACTGAATTCACAATTGAGGATTTC
CACAACACGTTCATGGACCTGATTGAGCAGGTGGAGAAGCAGACCTCTGTCGCCGACCTGCTGGCCTCC
TTCAATGACCAGAGCACCTCCGACTACCTTGTGGTCTACCTGCGGCTGCTCACCTCGGGCTACCTGCAG
CGCGAGAGCAAGTTCTTCGAGCACTTCATCGAGGGTGGACGGACTGTCAAGGAGTTCTGCCAGCAGGAG
GTGGAGCCCATGTGCAAGGAGAGCGACCACATCCACATCATTGCGCTGGCCCAGGCCCTCAGCGTGTCC
ATCCAGGTGGAGTACATGGACCGCGGCGAGGGCGGCACCACCAATCCGCACATCTTCCCTGAGGGCTCC
GAGCCCAAGGTCTACCTTCTCTACCGGCCTGGACACTACGATATCCTCTACAAA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGAT
TACAAGGATGACGACGATAAG
GTTTAAACGGCCGGC
>Peptide sequence encoded by RC210648
Blue=ORF Red=Cloning site Green=Tag(s)

MAAEEPQQQKQEPLGSDSEGVNCLAYDEAIMAQQDRIQQEIAVQNPLVSERLELSVLYKEYAEDDNIYQ
QKIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAKSKEDLVSQGFTEFTIEDF
HNTFMDLIEQVEKQTSVADLLASFNDQSTSDYLVVYLRLLTSGYLQRESKFFEHFIEGGRTVKEFCQQE
VEPMCKESDHIHIIALAQALSVSIQVEYMDRGEGGTTNPHIFPEGSEPKVYLLYRPGHYDILYK

myc-FLAG tag

Recombinant protein using RC210648 also available, TP310648M
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_017670
ORF Size 813 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_017670.3
RefSeq Size 2310 bp
RefSeq ORF 816 bp
Locus ID 55611
UniProt ID Q96FW1
Protein Families Protease
MW 31.3 kDa
Gene Summary The product of this gene is a member of the OTU (ovarian tumor) superfamily of predicted cysteine proteases. The encoded protein is a highly specific ubiquitin iso-peptidase, and cleaves ubiquitin from branched poly-ubiquitin chains but not from ubiquitinated substrates. It interacts with another ubiquitin protease and an E3 ubiquitin ligase that inhibits cytokine gene transcription in the immune system. It is proposed to function in specific ubiquitin-dependent pathways, possibly by providing an editing function for polyubiquitin chain growth. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...