DPH3 (NM_001047434) Human Tagged ORF Clone
CAT#: RC223888
- TrueORF®
DPH3 (Myc-DDK-tagged)-Human DPH3, KTI11 homolog (S. cerevisiae) (DPH3), transcript variant 2
ORF Plasmid: tGFP
"NM_001047434" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 3,990.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | DELGIP; DELGIP1; DESR1; DPH3A; KTI11; ZCSL2 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC223888 representing NM_001047434
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCAGTGTTTCATGACGAGGTGGAAATCGAGGACTTCCAATATGACGAGGACTCGGAGACGTATTTCT ATCCCTGCCCATGTGGAGATAACTTCTCCATCACCAAGGATCAGTTTGTGTGTGGAGAAACAGTCCCAGC CCCTTCAGCCAACAAAGAATTAGTTAAATGC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC223888 representing NM_001047434
Red=Cloning site Green=Tags(s) MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFSITKDQFVCGETVPAPSANKELVKC myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001047434 |
ORF Size | 171 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001047434.3 |
RefSeq Size | 3990 bp |
RefSeq ORF | 174 bp |
Locus ID | 285381 |
UniProt ID | Q96FX2 |
MW | 6.5 kDa |
Gene Summary | This gene encodes a CSL zinc finger-containing protein that is required for dipthamide biosynthesis. The encoded protein is necessary for the initial step in the modification of a histidine residue in elongation factor-2 to diphthamide. This modified residue is a target for ADP ribosylation by the bacterial toxins diphtheria toxin and Pseudomonas exotoxin A. Alternative splicing results in multiple transcript variants that encode the same isoform. [provided by RefSeq, Feb 2009] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC223888L3 | Lenti-ORF clone of DPH3 (Myc-DDK-tagged)-Human DPH3, KTI11 homolog (S. cerevisiae) (DPH3), transcript variant 2 |
CNY 5,890.00 |
|
RC223888L4 | Lenti-ORF clone of DPH3 (mGFP-tagged)-Human DPH3, KTI11 homolog (S. cerevisiae) (DPH3), transcript variant 2 |
CNY 5,890.00 |
|
RG223888 | DPH3 (tGFP-tagged) - Human DPH3, KTI11 homolog (S. cerevisiae) (DPH3), transcript variant 2 |
CNY 4,370.00 |
|
SC315392 | DPH3 (untagged)-Human DPH3, KTI11 homolog (S. cerevisiae) (DPH3), transcript variant 2 |
CNY 3,990.00 |