HPRT (HPRT1) (NM_000194) Human Mass Spec Standard
CAT#: PH300462
HPRT1 MS Standard C13 and N15-labeled recombinant protein (NP_000185)
View other "HPRT" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | HPRT1 MS Standard C13 and N15-labeled recombinant protein (NP_000185) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200462 |
Predicted MW | 24.6 kDa |
Protein Sequence |
>RC200462 protein sequence
Red=Cloning site Green=Tags(s) MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKG GYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTG KTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISE TGKAKYKA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000185 |
RefSeq Size | 1435 |
RefSeq ORF | 654 |
Synonyms | HGPRT; HPRT |
Locus ID | 3251 |
Cytogenetics | Xq26.2-q26.3 |
Summary | The protein encoded by this gene is a transferase, which catalyzes conversion of hypoxanthine to inosine monophosphate and guanine to guanosine monophosphate via transfer of the 5-phosphoribosyl group from 5-phosphoribosyl 1-pyrophosphate. This enzyme plays a central role in the generation of purine nucleotides through the purine salvage pathway. Mutations in this gene result in Lesch-Nyhan syndrome or gout.[provided by RefSeq, Jun 2009] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways | Drug metabolism - other enzymes, Metabolic pathways, Purine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400070 | HPRT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400070 | Transient overexpression lysate of hypoxanthine phosphoribosyltransferase 1 (HPRT1) |
CNY 3,080.00 |
|
TP300462 | Recombinant protein of human hypoxanthine phosphoribosyltransferase 1 (HPRT1), 20 µg |
CNY 2,900.00 |
|
TP720264 | Recombinant protein of human hypoxanthine phosphoribosyltransferase 1 (HPRT1) |
CNY 5,460.00 |