United States
Germany
Japan
United Kingdom
China
NME2 (NM_001018139) Human Mass Spec Standard
CAT＃: PH300680
NME2 MS Standard C13 and N15-labeled recombinant protein (NP_001018149)
View other "NME2" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
| Product Data | |
| Description | NME2 MS Standard C13 and N15-labeled recombinant protein (NP_001018149) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200680 |
| Predicted MW | 17.3 kDa |
| Protein Sequence |
>RC200680 protein sequence
Red=Cloning site Green=Tags(s) MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNS GPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELV DYKSCAHDWVYE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001018149 |
| RefSeq Size | 682 |
| RefSeq ORF | 456 |
| Synonyms | NDKB; NDPK-B; NDPKB; NM23-H2; NM23B; PUF |
| Locus ID | 4831 |
| Cytogenetics | 17q21.33 |
| Summary | Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by NME1) and 'B' (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants have been found for this gene. Read-through transcription from the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) that encode a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq, Nov 2010] |
| Protein Families | Druggable Genome, Transcription Factors |
| Protein Pathways | Metabolic pathways, Purine metabolism, Pyrimidine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419276 | NME2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422664 | NME2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422665 | NME2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422666 | NME2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419276 | Transient overexpression lysate of non-metastatic cells 2, protein (NM23B) expressed in (NME2), transcript variant 1 |
CNY 3,080.00 |
|
| LY422664 | Transient overexpression lysate of non-metastatic cells 2, protein (NM23B) expressed in (NME2), transcript variant 2 |
CNY 3,080.00 |
|
| LY422665 | Transient overexpression lysate of non-metastatic cells 2, protein (NM23B) expressed in (NME2), transcript variant 3 |
CNY 3,080.00 |
|
| LY422666 | Transient overexpression lysate of non-metastatic cells 2, protein (NM23B) expressed in (NME2), transcript variant 4 |
CNY 3,080.00 |
|
| TP300680 | Recombinant protein of human non-metastatic cells 2, protein (NM23B) expressed in (NME2), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
| TP760412 | Purified recombinant protein of Human non-metastatic cells 2, protein (NM23B) expressed in (NME2), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
|
| TP761637 | Purified recombinant protein of Human non-metastatic cells 2, protein (NM23B) expressed in (NME2), transcript variant 1, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
