Ribonuclease A (RNASE1) (NM_198235) Human Mass Spec Standard
CAT#: PH305620
RNASE1 MS Standard C13 and N15-labeled recombinant protein (NP_937878)
View other "Ribonuclease A" proteins (10)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RNASE1 MS Standard C13 and N15-labeled recombinant protein (NP_937878) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205620 |
Predicted MW | 17.6 kDa |
Protein Sequence |
>RC205620 protein sequence
Red=Cloning site Green=Tags(s) MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRNMTQGRCKP VNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEG SPYVPVHFDASVEDST myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_937878 |
RefSeq Size | 903 |
RefSeq ORF | 468 |
Synonyms | RAC1; RIB1; RNS1 |
Locus ID | 6035 |
Cytogenetics | 14q11.2 |
Summary | This gene encodes a member of the pancreatic-type of secretory ribonucleases, a subset of the ribonuclease A superfamily. The encoded endonuclease cleaves internal phosphodiester RNA bonds on the 3'-side of pyrimidine bases. It prefers poly(C) as a substrate and hydrolyzes 2',3'-cyclic nucleotides, with a pH optimum near 8.0. The encoded protein is monomeric and more commonly acts to degrade ds-RNA over ss-RNA. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401024 | RNASE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404956 | RNASE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404957 | RNASE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404958 | RNASE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401024 | Transient overexpression lysate of ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 4 |
CNY 3,080.00 |
|
LY404956 | Transient overexpression lysate of ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 3 |
CNY 3,080.00 |
|
LY404957 | Transient overexpression lysate of ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 2 |
CNY 3,080.00 |
|
LY404958 | Transient overexpression lysate of ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 1 |
CNY 3,080.00 |
|
TP305620 | Recombinant protein of human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP720748 | Purified recombinant protein of Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 4 |
CNY 5,460.00 |
其它Ribonuclease A产品