United States
Germany
Japan
United Kingdom
China
PRKAR1B (NM_002735) Human Mass Spec Standard
CAT＃: PH307809
PRKAR1B MS Standard C13 and N15-labeled recombinant protein (NP_002726)
View other "PRKAR1B" proteins (18)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
| Product Data | |
| Description | PRKAR1B MS Standard C13 and N15-labeled recombinant protein (NP_002726) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207809 |
| Predicted MW | 43.1 kDa |
| Protein Sequence |
>RC207809 protein sequence
Red=Cloning site Green=Tags(s) MASPPACPSEEDESLKGCELYVQLHGIQQVLKDCIVHLCISKPERPMKFLREHFEKLEKEENRQILARQK SNSQSDSHDEEVSPTPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPKDYKTMTALAKAISKNVLFAH LDDNERSDIFDAMFPVTHIAGETVIQQGNEGDNFYVVDQGEVDVYVNGEWVTNISEGGSFGELALIYGTP RAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGE KIVVQGEPGDDFYIITEGTASVLQRRSPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKL DRPRFERVLGPCSEILKRNIQRYNSFISLTV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002726 |
| RefSeq Size | 2512 |
| RefSeq ORF | 1143 |
| Synonyms | PRKAR1 |
| Locus ID | 5575 |
| Cytogenetics | 7p22.3 |
| Summary | The protein encoded by this gene is a regulatory subunit of cyclic AMP-dependent protein kinase A (PKA), which is involved in the signaling pathway of the second messenger cAMP. Two regulatory and two catalytic subunits form the PKA holoenzyme, disbands after cAMP binding. The holoenzyme is involved in many cellular events, including ion transport, metabolism, and transcription. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Aug 2015] |
| Protein Families | Druggable Genome |
| Protein Pathways | Apoptosis, Insulin signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400964 | PRKAR1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431887 | PRKAR1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431888 | PRKAR1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431889 | PRKAR1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431890 | PRKAR1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431891 | PRKAR1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400964 | Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 2 |
CNY 3,080.00 |
|
| LY431887 | Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 3 |
CNY 3,080.00 |
|
| LY431888 | Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 4 |
CNY 3,080.00 |
|
| LY431889 | Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 5 |
CNY 3,080.00 |
|
| LY431890 | Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 6 |
CNY 3,080.00 |
|
| LY431891 | Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 1 |
CNY 3,080.00 |
|
| TP307809 | Recombinant protein of human protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), 20 µg |
CNY 2,900.00 |
|
| TP328859 | Purified recombinant protein of Homo sapiens protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP328860 | Purified recombinant protein of Homo sapiens protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
| TP328861 | Purified recombinant protein of Homo sapiens protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 5, 20 µg |
CNY 2,900.00 |
|
| TP328862 | Purified recombinant protein of Homo sapiens protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 6, 20 µg |
CNY 2,900.00 |
|
| TP328863 | Purified recombinant protein of Homo sapiens protein kinase, cAMP-dependent, regulatory, type I, beta (PRKAR1B), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它PRKAR1B产品
