United States
Germany
Japan
United Kingdom
China
WTAP (NM_004906) Human Mass Spec Standard
CAT＃: PH309632
WTAP MS Standard C13 and N15-labeled recombinant protein (NP_004897)
View other "WTAP" proteins (13)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
| Product Data | |
| Description | WTAP MS Standard C13 and N15-labeled recombinant protein (NP_004897) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209632 |
| Predicted MW | 44.2 kDa |
| Protein Sequence |
>RC209632 protein sequence
Red=Cloning site Green=Tags(s) MTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEEKLKQQQQESA RRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQN ELSAWKFTPDSQTGKKLMAKCRMLIQENQELGRQLSQGRIAQLEAELALQKKYSEELKSSQDELNDFIIQ LDEEVEGMQSTILVLQQQLKETRQQLAQYQQQQSQASAPSTSRTTASEPVEQSEATSKDCSRLTNGPSNG SSSRQRTSGSGFHREGNTTEDDFPSSPGNGNKSSNSSEERTGRGGSGYVNQLSAGYESVDSPTGSENSLT HQSNDTDSSHDPQEEKAVSGKGNRTVGSRHVQNGLDSSVNVQGSVL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004897 |
| RefSeq Size | 2265 |
| RefSeq ORF | 1188 |
| Synonyms | Mum2 |
| Locus ID | 9589 |
| Cytogenetics | 6q25.3 |
| Summary | The Wilms tumor suppressor gene WT1 appears to play a role in both transcriptional and posttranscriptional regulation of certain cellular genes. This gene encodes a WT1-associating protein, which is a ubiquitously expressed nuclear protein. Like WT1 protein, this protein is localized throughout the nucleoplasm as well as in speckles and partially colocalizes with splicing factors. Alternative splicing of this gene results in several transcript variants encoding three different isoforms. [provided by RefSeq, Jul 2012] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407186 | WTAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC407187 | WTAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417661 | WTAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC430230 | WTAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407186 | Transient overexpression lysate of Wilms tumor 1 associated protein (WTAP), transcript variant 2 |
CNY 3,080.00 |
|
| LY407187 | Transient overexpression lysate of Wilms tumor 1 associated protein (WTAP), transcript variant 3 |
CNY 3,080.00 |
|
| LY417661 | Transient overexpression lysate of Wilms tumor 1 associated protein (WTAP), transcript variant 1 |
CNY 3,080.00 |
|
| LY430230 | Transient overexpression lysate of Wilms tumor 1 associated protein (WTAP), transcript variant 3 |
CNY 3,080.00 |
|
| PH323046 | WTAP MS Standard C13 and N15-labeled recombinant protein (NP_690596) |
CNY 19,520.00 |
|
| PH323099 | WTAP MS Standard C13 and N15-labeled recombinant protein (NP_690597) |
CNY 19,520.00 |
|
| TP309632 | Recombinant protein of human Wilms tumor 1 associated protein (WTAP), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP323046 | Recombinant protein of human Wilms tumor 1 associated protein (WTAP), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP323099 | Recombinant protein of human Wilms tumor 1 associated protein (WTAP), transcript variant 3, 20 µg |
CNY 2,900.00 |
