IL22 (NM_020525) Human Mass Spec Standard
CAT#: PH309995
IL22 MS Standard C13 and N15-labeled recombinant protein (NP_065386)
View other "IL22" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | IL22 MS Standard C13 and N15-labeled recombinant protein (NP_065386) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209995 |
Predicted MW | 20 kDa |
Protein Sequence |
>RC209995 protein sequence
Red=Cloning site Green=Tags(s) MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNT DVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLH IQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_065386 |
RefSeq Size | 1147 |
RefSeq ORF | 537 |
Synonyms | IL-21; IL-22; IL-D110; IL-TIF; ILTIF; TIFa; TIFIL-23; zcyto18 |
Locus ID | 50616 |
Cytogenetics | 12q15 |
Summary | This gene is a member of the IL10 family of cytokines that mediate cellular inflammatory responses. The encoded protein functions in antimicrobial defense at mucosal surfaces and in tissue repair. This protein also has pro-inflammatory properties and plays a role in in the pathogenesis of several intestinal diseases. [provided by RefSeq, Jul 2018] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412429 | IL22 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412429 | Transient overexpression lysate of interleukin 22 (IL22) |
CNY 3,080.00 |
|
TP309995 | Recombinant protein of human interleukin 22 (IL22), 20 µg |
CNY 2,900.00 |
|
TP721182 | Purified recombinant protein of Human interleukin 22 (IL22) |
CNY 5,460.00 |
|
TP723717 | Purified recombinant protein of Human interleukin 22 (IL22) |
CNY 5,330.00 |