United States
Germany
Japan
United Kingdom
China
HMGA2 (NM_003484) Human Mass Spec Standard
CAT＃: PH314681
HMGA2 MS Standard C13 and N15-labeled recombinant protein (NP_003475)
View other "HMGA2" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | HMGA2 MS Standard C13 and N15-labeled recombinant protein (NP_003475) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC214681 |
| Predicted MW | 11.3 kDa |
| Protein Sequence |
>RC214681 representing NM_003484
Red=Cloning site Green=Tags(s) MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSPSKAAQKKAEA TGEKRPRGRPRKWDNLLPRTSSKKKTSLGNSTKRSH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003475 |
| RefSeq Size | 1539 |
| RefSeq ORF | 318 |
| Synonyms | BABL; HMGI-C; HMGIC; LIPO; SRS5; STQTL9 |
| Locus ID | 8091 |
| Cytogenetics | 12q14.3 |
| Summary | This gene encodes a protein that belongs to the non-histone chromosomal high mobility group (HMG) protein family. HMG proteins function as architectural factors and are essential components of the enhancesome. This protein contains structural DNA-binding domains and may act as a transcriptional regulating factor. Identification of the deletion, amplification, and rearrangement of this gene that are associated with myxoid liposarcoma suggests a role in adipogenesis and mesenchymal differentiation. A gene knock out study of the mouse counterpart demonstrated that this gene is involved in diet-induced obesity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401189 | HMGA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418572 | HMGA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429148 | HMGA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401189 | Transient overexpression lysate of high mobility group AT-hook 2 (HMGA2), transcript variant 1 |
CNY 3,080.00 |
|
| LY418572 | Transient overexpression lysate of high mobility group AT-hook 2 (HMGA2), transcript variant 2 |
CNY 3,080.00 |
|
| LY429148 | Transient overexpression lysate of high mobility group AT-hook 2 (HMGA2), transcript variant 2 |
CNY 3,080.00 |
|
| TP314681 | Recombinant protein of human high mobility group AT-hook 2 (HMGA2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP761999 | Purified recombinant protein of Human high mobility group AT-hook 2 (HMGA2), transcript variant 1,full length, with N-terminal His-Trx tag, expressed in E. coli, 50ug |
CNY 2,050.00 |
