United States
Germany
Japan
United Kingdom
China
B7H3 (CD276) (NM_025240) Human Mass Spec Standard
CAT＃: PH315291
CD276 MS Standard C13 and N15-labeled recombinant protein (NP_079516)
View other "B7H3" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
| Cited in 1 publication. |
Product images
CNY 3,080.00
CNY 1,999.00
CNY 3,600.00
Specifications
| Product Data | |
| Description | CD276 MS Standard C13 and N15-labeled recombinant protein (NP_079516) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC215291 |
| Predicted MW | 33.6 kDa |
| Protein Sequence |
>RC215291 representing NM_025240
Red=Cloning site Green=Tags(s) MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLT DTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAA PYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRV VLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEE ENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_079516 |
| RefSeq Size | 2765 |
| RefSeq ORF | 948 |
| Synonyms | 4Ig-B7-H3; B7-H3; B7H3; B7RP-2 |
| Locus ID | 80381 |
| Cytogenetics | 15q24.1 |
| Summary | The protein encoded by this gene belongs to the immunoglobulin superfamily, and thought to participate in the regulation of T-cell-mediated immune response. Studies show that while the transcript of this gene is ubiquitously expressed in normal tissues and solid tumors, the protein is preferentially expressed only in tumor tissues. Additionally, it was observed that the 3' UTR of this transcript contains a target site for miR29 microRNA, and there is an inverse correlation between the expression of this protein and miR29 levels, suggesting regulation of expression of this gene product by miR29. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Cell adhesion molecules (CAMs) |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
B7-H3 Induces Ovarian Cancer Drugs Resistance Through An PI3K/AKT/BCL-2 Signaling Pathway
,null,
Cancer Management and Research
,PubMed ID 31819652
[CD276]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410803 | CD276 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422539 | CD276 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC425464 | CD276 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410803 | Transient overexpression lysate of CD276 molecule (CD276), transcript variant 2 |
CNY 3,080.00 |
|
| LY422539 | Transient overexpression lysate of CD276 molecule (CD276), transcript variant 1 |
CNY 4,840.00 |
|
| LY425464 | Transient overexpression lysate of CD276 molecule (CD276), transcript variant 1 |
CNY 3,080.00 |
|
| TP315291 | Recombinant protein of human CD276 molecule (CD276), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP700270 | Purified recombinant protein of human CD276 molecule (CD276), transcript variant 1, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
CNY 6,650.00 |
|
| TP723935 | Human B7-H3 Protein, mFc-His Tag |
CNY 5,876.00 |
