CNTF (NM_000614) Human Mass Spec Standard
CAT#: PH322331
CNTF MS Standard C13 and N15-labeled recombinant protein (NP_000605)
View other "CNTF" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Cited in 1 publication. |
Specifications
Product Data | |
Description | CNTF MS Standard C13 and N15-labeled recombinant protein (NP_000605) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222331 |
Predicted MW | 22.8 kDa |
Protein Sequence |
>RC222331 representing NM_000614
Red=Cloning site Green=Tags(s) MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEA ERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEAD GMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000605 |
RefSeq Size | 1891 |
RefSeq ORF | 600 |
Synonyms | HCNTF |
Locus ID | 1270 |
Cytogenetics | 11q12.1 |
Summary | The protein encoded by this gene is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. A mutation in this gene, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, but this phenotype is not causally related to neurologic disease. A read-through transcript variant composed of the upstream ZFP91 gene and CNTF sequence has been identified, but it is thought to be non-coding. Read-through transcription of ZFP91 and CNTF has also been observed in mouse. [provided by RefSeq, Oct 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
CNTF gene therapy confers lifelong neuroprotection in a mouse model of human retinitis pigmentosa
,null,
Molecular Therapy
,PubMed ID 25896245
[CNTF]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424606 | CNTF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424606 | Transient overexpression lysate of ciliary neurotrophic factor (CNTF) |
CNY 3,080.00 |
|
TP322331 | Recombinant protein of human ciliary neurotrophic factor (CNTF), 20 µg |
CNY 2,900.00 |
|
TP720608 | Purified recombinant protein of Human ciliary neurotrophic factor (CNTF) |
CNY 4,800.00 |