PD L2 (PDCD1LG2) (NM_025239) Human Mass Spec Standard
CAT#: PH324141
PDCD1LG2 MS Standard C13 and N15-labeled recombinant protein (NP_079515)
View other "PD L2" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | PDCD1LG2 MS Standard C13 and N15-labeled recombinant protein (NP_079515) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224141 |
Predicted MW | 30.8 kDa |
Protein Sequence |
>RC224141 representing NM_025239
Red=Cloning site Green=Tags(s) MIFLLLMLSLELQLHQIAALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHR ERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVKASYRKINTHILKVPETDEVE LTCQATGYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQ SQMEPRTHPTWLLHIFIPSCIIAFIFIATVIALRKQLCQKLYSSKDTTKRPVTTTKREVNSAI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_079515 |
RefSeq Size | 1518 |
RefSeq ORF | 819 |
Synonyms | B7DC; bA574F11.2; Btdc; CD273; PD-L2; PDCD1L2; PDL2 |
Locus ID | 80380 |
Cytogenetics | 9p24.1 |
Summary | Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Protein Pathways | Cell adhesion molecules (CAMs) |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410802 | PDCD1LG2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410802 | Transient overexpression lysate of programmed cell death 1 ligand 2 (PDCD1LG2) |
CNY 3,080.00 |
|
TP324141 | Recombinant protein of human programmed cell death 1 ligand 2 (PDCD1LG2), 20 µg |
CNY 2,900.00 |
|
TP700202 | Purified recombinant protein of human programmed cell death 1 ligand 2 (PDCD1LG2), extracellular domain expressed in human cells, 20 µg |
CNY 6,650.00 |
|
TP700203 | Purified recombinant protein of human programmed cell death 1 ligand 2 (PDCD1LG2), extracellular domain with C-terminal Fc fusion, expressed in human cells, 20 µg |
CNY 6,650.00 |
|
TP720737 | Purified recombinant protein of Human programmed cell death 1 ligand 2 (PDCD1LG2) |
CNY 5,460.00 |