Kallikrein 6 (KLK6) (NM_001012964) Human Recombinant Protein
CAT#: TP302146
Purified recombinant protein of Homo sapiens kallikrein-related peptidase 6 (KLK6), transcript variant B, 20 µg
View other "Kallikrein 6" proteins (12)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202146 protein sequence
Red=Cloning site Green=Tags(s) MKKLMVVLSLIAAAWAEEQNKLVHGGPCDKTSHPYQAALYTSGHLLCGGVLIHPLWVLTAAHCKKPNLQV FLGKHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQPLPLERDCSANTTSCHI LGWGKTADGDFPDTIQCAYIHLVSREECEHAYPGQITQNMLCAGDEKYGKDSCQGDSGGPLVCGDHLRGL VSWGNIPCGSKEKPGVYTNVCRYTNWIQKTIQAK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001012982 |
Locus ID | 5653 |
UniProt ID | Q92876, A0A024R4J8 |
Refseq Size | 1527 |
Cytogenetics | 19q13.41 |
Refseq ORF | 732 |
Synonyms | Bssp; hK6; Klk7; PRSS9; PRSS18; SP59 |
Summary | This gene encodes a member of the kallikrein subfamily of the peptidase S1 family of serine proteases. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. The encoded preproprotein is proteolytically processed to generate the mature protease. Expression of this protease is regulated by steroid hormones and may be elevated in multiple human cancers and in serum from psoriasis patients. The encoded protease may participate in the cleavage of amyloid precursor protein and alpha-synuclein, thus implicating this protease in Alzheimer's and Parkinson's disease, respectively. This gene is located in a gene cluster on chromosome 19. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Feb 2016] |
Protein Families | Druggable Genome, Protease, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400982 | KLK6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422842 | KLK6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422843 | KLK6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400982 | Transient overexpression lysate of kallikrein-related peptidase 6 (KLK6), transcript variant A |
CNY 3,080.00 |
|
LY422842 | Transient overexpression lysate of kallikrein-related peptidase 6 (KLK6), transcript variant B |
CNY 3,080.00 |
|
LY422843 | Transient overexpression lysate of kallikrein-related peptidase 6 (KLK6), transcript variant C |
CNY 3,080.00 |
|
PH302146 | KLK6 MS Standard C13 and N15-labeled recombinant protein (NP_001012982) |
CNY 14,250.00 |
|
PH318647 | KLK6 MS Standard C13 and N15-labeled recombinant protein (NP_002765) |
CNY 19,520.00 |
|
PH321436 | KLK6 MS Standard C13 and N15-labeled recombinant protein (NP_001012983) |
CNY 14,250.00 |
|
TP318647 | Recombinant protein of human kallikrein-related peptidase 6 (KLK6), transcript variant A, 20 µg |
CNY 2,900.00 |
|
TP321436 | Purified recombinant protein of Homo sapiens kallikrein-related peptidase 6 (KLK6), transcript variant C, 20 µg |
CNY 2,900.00 |
|
TP720315 | Recombinant protein of human kallikrein-related peptidase 6 (KLK6), transcript variant B |
CNY 5,460.00 |
其它Kallikrein 6产品