DDX3 (DDX3X) (NM_001356) Human Recombinant Protein
CAT#: TP304171
Recombinant protein of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, X-linked (DDX3X), 20 µg
View other "DDX3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
热销蛋白,享双倍赠礼
CNY 2,900.00
CNY 6,650.00
Cited in 2 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204171 protein sequence
Red=Cloning site Green=Tags(s) MSHVAVENALGLDQQFAGLDLNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDKDSSGWSSSKDKDAYS SFGSRSDSRGKSSFFSDRGSGSRGRFDDRGRSDYDGIGSRGDRSGFGKFERGGNSRWCDKSDEDDWSKPL PPSERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHA IPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAV QIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEAD RMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVV WVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSG KSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLL VEAKQEVPSWLENMAYEHHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGS SRGFGGGGYGGFYNSDGYGGNYNSQGVDWWGN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 73.1 kDa |
Concentration | >0.1 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Biolayer interferometry (BLI) assay (PMID: 25496916) |
Reference Data | |
RefSeq | NP_001347 |
Locus ID | 1654 |
UniProt ID | O00571 |
Refseq Size | 5433 |
Cytogenetics | Xp11.4 |
Refseq ORF | 1986 |
Synonyms | CAP-Rf; DBX; DDX3; DDX14; HLP2; MRX102; MRXSSB |
Summary | The protein encoded by this gene is a member of the large DEAD-box protein family, that is defined by the presence of the conserved Asp-Glu-Ala-Asp (DEAD) motif, and has ATP-dependent RNA helicase activity. This protein has been reported to display a high level of RNA-independent ATPase activity, and unlike most DEAD-box helicases, the ATPase activity is thought to be stimulated by both RNA and DNA. This protein has multiple conserved domains and is thought to play roles in both the nucleus and cytoplasm. Nuclear roles include transcriptional regulation, mRNP assembly, pre-mRNA splicing, and mRNA export. In the cytoplasm, this protein is thought to be involved in translation, cellular signaling, and viral replication. Misregulation of this gene has been implicated in tumorigenesis. This gene has a paralog located in the nonrecombining region of the Y chromosome. Pseudogenes sharing similarity to both this gene and the DDX3Y paralog are found on chromosome 4 and the X chromosome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014] |
Protein Families | ES Cell Differentiation/IPS |
Protein Pathways | RIG-I-like receptor signaling pathway |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
RNA G-quadruplex structures control ribosomal protein production
,null,
Scientific Reports
,PubMed ID 34815422
[DDX3X]
|
A HIV-1 Tat mutant protein disrupts HIV-1 Rev function by targeting the DEAD-box RNA helicase DDX1
,Lin, MH;Sivakumaran, H;Jones, A;Li, D;Harper, C;Wei, T;Jin, H;Rustanti, L;Meunier, FA;Spann, K;Harrich, D;,
Retrovirology
,PubMed ID 25496916
[DDX3X]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419970 | DDX3X HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419970 | Transient overexpression lysate of DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, X-linked (DDX3X) |
CNY 3,080.00 |
|
PH304171 | DDX3X MS Standard C13 and N15-labeled recombinant protein (NP_001347) |
CNY 19,520.00 |