Parvin alpha (PARVA) (NM_018222) Human Recombinant Protein
CAT#: TP305086
Recombinant protein of human parvin, alpha (PARVA), 20 µg
View other "Parvin alpha" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205086 protein sequence
Red=Cloning site Green=Tags(s) MATSPQKSPSVPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEVSELQEEGMNAINLPLSPIPFELDP EDTMLEENEVRTMVDPNSRSDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLESEK LNVAEVTQSEIAQKQKLQTVLEKINETLKLPPRSIKWNVDSVHAKSLVAILHLLVALSQYFRAPIRLPDH VSIQVVVVQKREGILQSRQIQEEITGNTEALSGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLN LEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIV NCDLKSTLRVLYNLFTKYRNVE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060692 |
Locus ID | 55742 |
UniProt ID | Q9NVD7 |
Refseq Size | 8719 |
Cytogenetics | 11p15.3 |
Refseq ORF | 1116 |
Synonyms | CH-ILKBP; MXRA2 |
Summary | This gene encodes a member of the parvin family of actin-binding proteins. Parvins are associated with focal contacts and contain calponin homology domains that bind to actin filaments. The encoded protein is part of the integrin-linked kinase signaling complex and plays a role in cell adhesion, motility and survival. [provided by RefSeq, Dec 2010] |
Protein Pathways | Focal adhesion |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413202 | PARVA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413202 | Transient overexpression lysate of parvin, alpha (PARVA) |
CNY 3,080.00 |
|
PH305086 | PARVA MS Standard C13 and N15-labeled recombinant protein (NP_060692) |
CNY 19,520.00 |
|
TP720856 | Purified recombinant protein of Human parvin, alpha (PARVA) |
CNY 5,460.00 |
其它Parvin alpha产品