Kallikrein 8 (KLK8) (NM_007196) Human Recombinant Protein
CAT#: TP308152
Recombinant protein of human kallikrein-related peptidase 8 (KLK8), transcript variant 1, 20 µg
View other "Kallikrein 8" proteins (10)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208152 protein sequence
Red=Cloning site Green=Tags(s) MGRPRPRAAKTWMFLLLLGGAWAGHSRAQEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLT AAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPIS LADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDVMVCAGSSKGADTCQG DSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_009127 |
Locus ID | 11202 |
UniProt ID | O60259 |
Refseq Size | 1023 |
Cytogenetics | 19q13.41 |
Refseq ORF | 780 |
Synonyms | HNP; NP; NRPN; PRSS19; TADG14 |
Summary | Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in tandem in a gene cluster on chromosome 19. The encoded protein may be involved in proteolytic cascade in the skin and may serve as a biomarker for ovarian cancer. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408269 | KLK8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416130 | KLK8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC430111 | KLK8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408269 | Transient overexpression lysate of kallikrein-related peptidase 8 (KLK8), transcript variant 2 |
CNY 3,080.00 |
|
LY416130 | Transient overexpression lysate of kallikrein-related peptidase 8 (KLK8), transcript variant 1 |
CNY 3,080.00 |
|
LY430111 | Transient overexpression lysate of kallikrein-related peptidase 8 (KLK8), transcript variant 2 |
CNY 3,080.00 |
|
PH308152 | KLK8 MS Standard C13 and N15-labeled recombinant protein (NP_009127) |
CNY 19,520.00 |
|
TP710038 | Recombinant protein of human kallikrein-related peptidase 8 (KLK8), transcript variant 1, residues 33-260aa, with C-terminal DDK tag, expressed in sf9 cells. |
CNY 4,020.00 |
|
TP720648 | Purified recombinant protein of Human kallikrein-related peptidase 8 (KLK8), transcript variant 1 |
CNY 5,460.00 |
|
TP761586 | Purified recombinant protein of Human kallikrein-related peptidase 8 (KLK8), transcript variant 1, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
其它Kallikrein 8产品