ZFP91 (NM_053023) Human Recombinant Protein

CAT#: TP308217

Recombinant protein of human zinc finger protein 91 homolog (mouse) (ZFP91), 20 µg

Size: 20 ug 100 ug 1 mg



  View other "ZFP91" proteins (3)

Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00

CNY 6,650.00


货期*
现货

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


ZFP91 rabbit polyclonal antibody
    • 100 ul

CNY 1,999.00
CNY 3,280.00

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>Peptide sequence encoded by RC208217
Blue=ORF Red=Cloning site Green=Tag(s)

GGACRDH*QPRAEGRSGPRPGRCGRRRRSCVPPEEGRVSPPAEEQPQRQASRRPRAAAPGREVPVSSSGQ
EESATPMHRKSNN**RSQGRKRGRRRFCPPSGSFHCCI*T*PGLA***DICFSPS*YREHPKLSVQDRFIAAHLQVR
TKYRPT*L*CWRRASVSRWH**RGRGGGRRDVNQ*RGDTIQR*SKR*DLQTPLRKGNPKATEKIREGKRREGEEGN
*SGSRGGGERRGE*N*RG*GTSKEERKKTKR*QKSTFTQKEKKASNPVCPL*DGRMWNCPCPSSLFAAPH*IPAFA
EEEICMSPSLLWTTLQASEATSATCQTSYRSKGLYL*ILCSGLQEFPQSGSAPDDSHWREAITM*DLWIYL
STKGIS*LAHEET*CRLLLPVFLQYLWQKI*EEGQRSGTQGKKPP*GADCRSSGCQCRRPHHQHRYLGH*PRVP
DAAFRWSGSSSSS*ALGKLNLWRVPTVRS*RDVKVILQWDGTGEPDG*WEDLCGKRQQWRH*RAGYELRYTRC
YHRGSD*RFRLCRT

myc-FLAG tag

Recombinant protein using RC208217 also available, TP308217M
Tag C-Myc/DDK
Predicted MW 63.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_444251
Locus ID 80829
UniProt ID Q96JP5, A0A024R4Z1
Refseq Size 5735
Cytogenetics 11q12.1
Refseq ORF 1707
Synonyms DMS-8; DSM-8; DSM8; FKSG11; PZF; ZFP-91; ZNF757
Summary The protein encoded by this gene is a member of the zinc finger family of proteins. The gene product contains C2H2-type domains, which are the classical zinc finger domains found in numerous nucleic acid-binding proteins. This protein functions as a regulator of the non-canonical NF-kappaB pathway in lymphotoxin-beta receptor signaling. Alternative splicing results in multiple transcript variants. A read-through transcript variant composed of ZFP91 and the downstream CNTF gene sequence has been identified, but it is thought to be non-coding. Read-through transcription of ZFP91 and CNTF has also been observed in mouse. A ZFP91-related pseudogene has also been identified on chromosome 2. [provided by RefSeq, Oct 2010]
Protein Families Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Other Versions

Customer Reviews 
Loading...