BCL2L2 (NM_004050) Human Recombinant Protein
CAT#: TP311152
Recombinant protein of human BCL2-like 2 (BCL2L2), 20 µg
View other "BCL2L2" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211152 protein sequence
Red=Cloning site Green=Tags(s) MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHV TPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHS SGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004041 |
Locus ID | 599 |
UniProt ID | Q92843 |
Refseq Size | 3621 |
Cytogenetics | 14q11.2 |
Refseq ORF | 579 |
Synonyms | BCL-W; BCL2-L-2; BCLW; PPP1R51 |
Summary | This gene encodes a member of the BCL-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators. Expression of this gene in cells has been shown to contribute to reduced cell apoptosis under cytotoxic conditions. Studies of the related gene in mice indicated a role in the survival of NGF- and BDNF-dependent neurons. Mutation and knockout studies of the mouse gene demonstrated an essential role in adult spermatogenesis. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream PABPN1 (poly(A) binding protein, nuclear 1) gene. [provided by RefSeq, Dec 2010] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401312 | BCL2L2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401312 | Transient overexpression lysate of BCL2-like 2 (BCL2L2) |
CNY 3,080.00 |
|
PH311152 | BCL2L2 MS Standard C13 and N15-labeled recombinant protein (NP_004041) |
CNY 19,520.00 |
|
TP720086 | Recombinant protein of human BCL2-like 2 (BCL2L2) |
CNY 4,060.00 |