PPM1G (NM_177983) Human Recombinant Protein
CAT#: TP313685
Recombinant protein of human protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma isoform (PPM1G), transcript variant 1, 20 µg
View other "PPM1G" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213685 protein sequence
Red=Cloning site Green=Tags(s) MGAYLSQPNTVKCSGDGVGAPRLPLPYGFSAMQGWRVSMEDAHNCIPELDSETAMFSVYDGHGGEEVALY CAKYLPDIIKDQKAYKEGKLQKALEDAFLAIDAKLTTEEVIKELAQIAGRPTEDEDEKEKVADEDDVDNE EAALLHEEATMTIEELLTRYGQNCHKGPPHSKSGGGTGEEPGSQGLNGEAGPEDSTRETPSQENGPTAKA YTGFSSNSERGTEAGQVGEPGIPTGEAGPSCSSASDKLPRVAKSKFFEDSEDESDEAEEEEEDSEECSEE EDGYSSEEAENEEDEDDTEEAEEDDEEEEEEMMVPGMEGKEEPGSDSGTTAVVALIRGKQLIVANAGDSR CVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNKNLPPEEQMISA LPDIKVLTLTDDHEFMVIACDGIWNVMSSQEVVDFIQSKISQRDENGELRLLSSIVEELLDQCLAPDTSG DGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSDKKKKAKRD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 59.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | In vitro phosphatase assay (PMID: 25658463) |
Reference Data | |
RefSeq | NP_817092 |
Locus ID | 5496 |
UniProt ID | O15355, Q6IAU5 |
Refseq Size | 2302 |
Cytogenetics | 2p23.3 |
Refseq ORF | 1638 |
Synonyms | PP2CG; PP2CGAMMA; PPP2CG |
Summary | The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase is found to be responsible for the dephosphorylation of Pre-mRNA splicing factors, which is important for the formation of functional spliceosome. Studies of a similar gene in mice suggested a role of this phosphatase in regulating cell cycle progression. [provided by RefSeq, Apr 2010] |
Protein Families | Druggable Genome, Phosphatase |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
WIP1 Phosphatase as a Potential Therapeutic Target in Neuroblastoma
,Richter, M;Dayaram, T;Gilmartin, AG;Ganji, G;Pemmasani, SK;Van Der Key, H;Shohet, JM;Donehower, LA;Kumar, R;,
PLoS ONE
,PubMed ID 25658463
[PPM1G]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400953 | PPM1G HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC406071 | PPM1G HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400953 | Transient overexpression lysate of protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma isoform (PPM1G), transcript variant 2 |
CNY 3,080.00 |
|
LY406071 | Transient overexpression lysate of protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma isoform (PPM1G), transcript variant 1 |
CNY 3,080.00 |
|
PH300439 | PPM1G MS Standard C13 and N15-labeled recombinant protein (NP_002698) |
CNY 19,520.00 |
|
PH313685 | PPM1G MS Standard C13 and N15-labeled recombinant protein (NP_817092) |
CNY 19,520.00 |
|
TP300439 | Recombinant protein of human protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma isoform (PPM1G), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP720138 | Recombinant protein of human protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma isoform (PPM1G), transcript variant 1 |
CNY 4,550.00 |