UPB1 (NM_016327) Human Recombinant Protein
CAT#: TP323365
Recombinant protein of human ureidopropionase, beta (UPB1), 20 µg
View other "UPB1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223365 protein sequence
Red=Cloning site Green=Tags(s) MAGAEWKSLEECLEKHLPLPDLQEVKRVLYGKELRKLDLPREAFEAASREDFELQGYAFEAAEEQLRRPR IVHVGLVQNRIPLPANAPVAEQVSALHRRIKAIVEVAAMCGVNIICFQEAWTMPFAFCTREKLPWTEFAE SAEDGPTTRFCQKLAKNHDMVVVSPILERDSEHGDVLWNTAVVISNSGAVLGKTRKNHIPRVGDFNESTY YMEGNLGHPVFQTQFGRIAVNICYGRHHPLNWLMYSINGAEIIFNPSATIGALSESLWPIEARNAAIANH CFTCAINRVGTEHFPNEFTSGDGKKAHQDFGYFYGSSYVAAPDSSRTPGLSRSRDGLLVAKLDLNLCQQV NDVWNFKMTGRYEMYARELAEAVKSNYSPTIVKE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 43 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057411 |
Locus ID | 51733 |
UniProt ID | Q9UBR1, A0A024R1H3, B3KNC1 |
Refseq Size | 2167 |
Cytogenetics | 22q11.23 |
Refseq ORF | 1152 |
Synonyms | BUP1 |
Summary | This gene encodes a protein that belongs to the CN hydrolase family. Beta-ureidopropionase catalyzes the last step in the pyrimidine degradation pathway. The pyrimidine bases uracil and thymine are degraded via the consecutive action of dihydropyrimidine dehydrogenase (DHPDH), dihydropyrimidinase (DHP) and beta-ureidopropionase (UP) to beta-alanine and beta-aminoisobutyric acid, respectively. UP deficiencies are associated with N-carbamyl-beta-amino aciduria and may lead to abnormalities in neurological activity. [provided by RefSeq, Jul 2008] |
Protein Pathways | beta-Alanine metabolism, Drug metabolism - other enzymes, Metabolic pathways, Pantothenate and CoA biosynthesis, Pyrimidine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414060 | UPB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414060 | Transient overexpression lysate of ureidopropionase, beta (UPB1) |
CNY 3,080.00 |
|
PH323365 | UPB1 MS Standard C13 and N15-labeled recombinant protein (NP_057411) |
CNY 19,520.00 |
|
TP720186 | Recombinant protein of human ureidopropionase, beta (UPB1) |
CNY 5,460.00 |
|
TP760830 | Purified recombinant protein of Human ureidopropionase, beta (UPB1), full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |