SUGT1 (NM_001130912) Human Recombinant Protein
CAT#: TP325548
Purified recombinant protein of Homo sapiens SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae) (SUGT1), transcript variant 1, 20 µg
View other "SUGT1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225548 representing NM_001130912
Red=Cloning site Green=Tags(s) MAAAAAGTATSQRFFQSFSDALIDEDPQAALEELTKALEQKPDDAQYYCQRAYCHILLGNYCVAVADAKK SLELNPNNSTAMLRKGICEYHEKNYAAALETFTEGQKLDIETGFHRVGQAGLQLLTSSDPPALDSQSAGI TGADANFSVWIKRCQEAQNGSESEVWTHQSKIKYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALV KLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSS SPYTRNWDKLVGEIKEEEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKR KVEINPPDDMEWKKY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001124384 |
Locus ID | 10910 |
UniProt ID | Q9Y2Z0, A8K7W3 |
Cytogenetics | 13q14.3 |
Refseq ORF | 1095 |
Synonyms | SGT1 |
Summary | This gene encodes a highly conserved nuclear protein involved in kinetochore function and required for the G1/S and G2/M transitions. This protein interacts with heat shock protein 90. Alternative splicing results in multiple transcript variants. Pseudogenes for this gene have been defined on several different chromosomes. [provided by RefSeq, Mar 2016] |
Protein Pathways | NOD-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416475 | SUGT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427302 | SUGT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416475 | Transient overexpression lysate of SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae) (SUGT1), transcript variant 2 |
CNY 3,080.00 |
|
LY427302 | Transient overexpression lysate of SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae) (SUGT1), transcript variant 1 |
CNY 3,080.00 |
|
PH301676 | SUGT1 MS Standard C13 and N15-labeled recombinant protein (NP_006695) |
CNY 19,520.00 |
|
PH325548 | SUGT1 MS Standard C13 and N15-labeled recombinant protein (NP_001124384) |
CNY 14,250.00 |
|
TP301676 | Recombinant protein of human SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae) (SUGT1), transcript variant 2, 20 µg |
CNY 2,900.00 |