LTA (NM_001159740) Human Recombinant Protein
CAT#: TP328758
Recombinant protein of human lymphotoxin alpha (TNF superfamily, member 1) (LTA), transcript variant 1, 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC228758 protein sequence
Red=Cloning site Green=Tags(s) MTPPERLFLPRVRGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGD PSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSS QYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001153212 |
Locus ID | 4049 |
UniProt ID | P01374, Q5STV3 |
Refseq Size | 1474 |
Cytogenetics | 6p21.33 |
Refseq ORF | 615 |
Synonyms | LT; TNFB; TNFSF1; TNLG1E |
Summary | The encoded protein, a member of the tumor necrosis factor family, is a cytokine produced by lymphocytes. The protein is highly inducible, secreted, and forms heterotrimers with lymphotoxin-beta which anchor lymphotoxin-alpha to the cell surface. This protein also mediates a large variety of inflammatory, immunostimulatory, and antiviral responses, is involved in the formation of secondary lymphoid organs during development and plays a role in apoptosis. Genetic variations in this gene are associated with susceptibility to leprosy type 4, myocardial infarction, non-Hodgkin's lymphoma, and psoriatic arthritis. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jul 2012] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Antigen processing and presentation, Cytokine-cytokine receptor interaction, Type I diabetes mellitus |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424627 | LTA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431786 | LTA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424627 | Transient overexpression lysate of lymphotoxin alpha (TNF superfamily, member 1) (LTA), transcript variant 2 |
CNY 3,080.00 |
|
LY431786 | Transient overexpression lysate of lymphotoxin alpha (TNF superfamily, member 1) (LTA), transcript variant 1 |
CNY 3,080.00 |
|
PH303741 | LTA MS Standard C13 and N15-labeled recombinant protein (NP_000586) |
CNY 19,520.00 |
|
TP303741 | Recombinant protein of human lymphotoxin alpha (TNF superfamily, member 1) (LTA), 20 µg |
CNY 2,900.00 |
|
TP720614 | Purified recombinant protein of Human lymphotoxin alpha (TNF superfamily, member 1) (LTA), transcript variant 2 |
CNY 4,800.00 |