United States
Germany
Japan
United Kingdom
China
Synaptotagmin 3 (SYT3) (NM_001160328) Human Recombinant Protein
CAT＃: TP328969
Recombinant protein of human synaptotagmin III (SYT3), transcript variant 2, 20 µg
View other "Synaptotagmin 3" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC228969 protein sequence
Red=Cloning site Green=Tags(s) MSGDYEDDLCRRALILVSDLCARVRDADTNDRCQEFNDRIRGYPRGPDADISVSLLSVIVTFCGIVLLGV SLFVSWKLCWVPWRDKGGSAVGGGPLRKDLGPGVGLAGLVGGGGHHLAAGLGGHPLLGGPHHHAHAAHHP PFAELLEPGSLGGSDTPEPSYLDMDSYPEAAAAAVAAGVKPSQTSPELPSEGGAGSGLLLLPPSGGGLPS AQSHQQVTSLAPTTRYPALPRPLTQQTLTSQPDPSSEERPPALPLPLPGGEEKAKLIGQIKPELYQGTGP GGRRSGGGPGSGEAGTGAPCGRISFALRYLYGSDQLVVRILQAMDLPAKDSNGFSDPYVKIYLLPDRKKK FQTKVHRKTLNPVFNETFQFSVPLAELAQRKLHFSVYDFDRFSRHDLIGQVVLDNLLELAEQPPDRPLWR DIVEGGSEKADLGELNFSLCYLPTAGRLTVTIIKASNLKAMDLTGFSDPYVKASLISEGRRLKKRKTSIK KNTLNPTYNEALVFDVAPESVENVGLSIAVVDYDCIGHNEVIGVCRVGPDAADPHGREHWAEMLANPRKP VEHWHQLVEEKTVTSFTKGSKGLSEKENSE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 63.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001153800 |
| Locus ID | 84258 |
| UniProt ID | Q9BQG1, A0A024R4I9 |
| Refseq Size | 2857 |
| Cytogenetics | 19q13.33 |
| Refseq ORF | 1770 |
| Synonyms | SytIII |
| Summary | Ca(2+) sensor involved in Ca(2+)-dependent exocytosis of secretory vesicles through Ca(2+) and phospholipid binding to the C2 domain. Ca(2+) induces binding of the C2-domains to phospholipid membranes and to assembled SNARE-complexes; both actions contribute to triggering exocytosis (By similarity). Plays a role in dendrite formation by melanocytes (PubMed:23999003).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Secreted Protein, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410240 | SYT3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431996 | SYT3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431997 | SYT3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410240 | Transient overexpression lysate of synaptotagmin III (SYT3), transcript variant 1 |
CNY 3,080.00 |
|
| LY431996 | Transient overexpression lysate of synaptotagmin III (SYT3), transcript variant 2 |
CNY 3,080.00 |
|
| LY431997 | Transient overexpression lysate of synaptotagmin III (SYT3), transcript variant 3 |
CNY 3,080.00 |
|
| PH305963 | SYT3 MS Standard C13 and N15-labeled recombinant protein (NP_115674) |
CNY 19,520.00 |
|
| TP305963 | Recombinant protein of human synaptotagmin III (SYT3), 20 µg |
CNY 2,900.00 |
|
| TP328970 | Recombinant protein of human synaptotagmin III (SYT3), transcript variant 3, 20 µg |
CNY 2,900.00 |
其它Synaptotagmin 3产品
