DCAMKL1 (DCLK1) (NM_001195416) Human Recombinant Protein
CAT#: TP331229
Purified recombinant protein of Homo sapiens doublecortin-like kinase 1 (DCLK1), transcript variant 3, 20 µg
View other "DCAMKL1" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC231229 representing NM_001195416
Red=Cloning site Green=Tags(s) MLELIEVNGTPGSQLSTPRSGKSPSPSPTSPGSLRKQRSSQHGGSSTSLASTKVCSSMDENDGPGEEVSE EGFQIPATITERYKVGRTIGDGNFAVVKECVERSTAREYALKIIKKSKCRGKEHMIQNEVSILRRVKHPN IVLLIEEMDVPTELYLVMELVKGGDLFDAITSTNKYTERDASGMLYNLASAIKYLHSLNIVHRDIKPENL LVYEHQDGSKSLKLGDFGLATIVDGPLYTVCGTPTYVAPEIIAETGYGLKVDIWAAGVITYILLCGFPPF RGSGDDQEVLFDQILMGQVDFPSPYWDNVSDSAKELITMMLLVDVDQRFSAVQVLEHPWVNDDGLPENEH QLSVAGKIKKHFNTGPKPNSTAAGVSVIATTALDKERQVFRRRRNQDVRSRYKAQPAPPELNSESEDYSP SSSETVRSPNSPF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 48.1 |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | ELISA standard (PMID: 29577277) |
Reference Data | |
RefSeq | NP_001182345 |
Locus ID | 9201 |
UniProt ID | O15075, B7Z5K4, O15075-4 |
Cytogenetics | 13q13.3 |
Refseq ORF | 1299 |
Synonyms | CL1; CLICK1; DCAMKL1; DCDC3A; DCLK |
Summary | This gene encodes a member of the protein kinase superfamily and the doublecortin family. The protein encoded by this gene contains two N-terminal doublecortin domains, which bind microtubules and regulate microtubule polymerization, a C-terminal serine/threonine protein kinase domain, which shows substantial homology to Ca2+/calmodulin-dependent protein kinase, and a serine/proline-rich domain in between the doublecortin and the protein kinase domains, which mediates multiple protein-protein interactions. The microtubule-polymerizing activity of the encoded protein is independent of its protein kinase activity. The encoded protein is involved in several different cellular processes, including neuronal migration, retrograde transport, neuronal apoptosis and neurogenesis. This gene is up-regulated by brain-derived neurotrophic factor and associated with memory and general cognitive abilities. Multiple transcript variants generated by two alternative promoter usage and alternative splicing have been reported, but the full-length nature and biological validity of some variants have not been defined. These variants encode different isoforms, which are differentially expressed and have different kinase activities.[provided by RefSeq, Sep 2010] |
Protein Families | Druggable Genome, Protein Kinase |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Alternative splice variants of DCLK1 mark cancer stem cells, promote self-renewal and drug-resistance, and can be targeted to inhibit tumorigenesis in kidney cancer
,Ge, Y;Weygant, N;Qu, D;May, R;Berry, WL;Yao, J;Chandrakesan, P;Zheng, W;Zhao, L;Zhao, KL;Drake, M;Vega, KJ;Bronze, MS;Tomasek, JJ;An, G;Houchen, CW;,
Int. J. Cancer
,PubMed ID 29577277
[DCLK1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417785 | DCLK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY417785 | Transient overexpression lysate of doublecortin-like kinase 1 (DCLK1) |
CNY 4,840.00 |
|
PH317050 | DCLK1 MS Standard C13 and N15-labeled recombinant protein (NP_004725) |
CNY 19,520.00 |
|
TP317050 | Recombinant protein of human doublecortin-like kinase 1 (DCLK1), 20 µg |
CNY 2,900.00 |
其它DCAMKL1产品