Morf4l2 (NM_001168229) Mouse Recombinant Protein

CAT#: TP503932

Purified recombinant protein of Mouse mortality factor 4 like 2 (Morf4l2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203932 protein sequence
Red=Cloning site Green=Tags(s)

MSSRKQASQTRGQQSAEEDNFKKPTRSNMQRSKMRGAASGKKSAGSQPKNLDPALPGRWGGRSAENPPSG
SVRKTRKNKQKAPGNGDGGSTSEVPQPPRKKRARADPTVESEEAFKSRMEVKVKIPEELKPWLVEDWDLV
TRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVGGIKEYFNVMLGTQLLYKFERPQYAEI
LLAHPDAPMSQIYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVAS
ADYHRKAL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 32.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001161701
Locus ID 56397
UniProt ID Q9R0Q4
Refseq Size 1803
Cytogenetics X F1
Refseq ORF 867
Synonyms 2410017O14Rik; mKIAA0026; Mrgx; Sid393p
Summary Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Also component of the MSIN3A complex which acts to repress transcription by deacetylation of nucleosomal histones (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...