Jam3 (NM_023277) Mouse Recombinant Protein

CAT#: TP504404

Purified recombinant protein of Mouse junction adhesion molecule 3 (Jam3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204404 protein sequence
Red=Cloning site Green=Tags(s)

MALSRRLRLRLYARLPDFFLLLLFRGCMIEAVNLKSSNRNPVVHEFESVELSCIITDSQTSDPRIEWKKI
QDGQTTYVYFDNKIQGDLAGRTDVFGKTSLRIWNVTRSDSAIYRCEVVALNDRKEVDEITIELIVQVKPV
TPVCRIPAAVPVGKTATLQCQESEGYPRPHYSWYRNDVPLPTDSRANPRFQNSSFHVNSETGTLVFNAVH
KDDSGQYYCIASNDAGAARCEGQDMEVYDLNIAGIIGGVLVVLIVLAVITMGICCAYRRGCFISSKQDGE
SYKSPGKHDGVNYIRTSEEGDFRHKSSFVI

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 34.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_075766
Locus ID 83964
UniProt ID Q9D8B7
Refseq Size 1986
Cytogenetics 9 A4
Refseq ORF 933
Synonyms 1110002N23Rik; JAM-3; JAM-C; Jcam3
Summary Mediates cell-cell adhesion. Functions as counter-receptor for JAM2 (PubMed:15372036). Functions as a counter-receptor for ITGAM, mediating leukocyte-platelet interactions and is involved in the regulation of transepithelial migration of polymorphonuclear neutrophils (PMN) (By similarity). Plays a role in angiogenesis (PubMed:15994945). May play a role in the regulation of cell migration (By similarity). Required for normal polarization and acrosome formation in developing spermatids, and for normal male fertility (PubMed:15372036).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...