Pim2 (BC027376) Mouse Recombinant Protein

CAT#: TP504426

Purified recombinant protein of Mouse proviral integration site 2 (cDNA clone MGC:37188 IMAGE:4954711), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
PIM2 Antibody - middle region
    • 50 ug

CNY 4,628.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204426 protein sequence
Red=Cloning site Green=Tags(s)

MLTKPLQGHPSPPVTPTQPPGGKDRAAFEAEYRLGPLLGKGGFGTVFAGHRVTDRRQVAIKVISRNRVLG
WSTVSDSVTCPLEVALLWKVGEGNGHPGVIRLLDWFETPEGFMLVLERPMPAQDLFDYITEKGPLGESCS
RSFFTQVVAAVQHCHARGVVHRDIKDENILIDLCRGSIKLIDFGSGALLHDEPYTDFDGTRVYSPPEWIS
RHQYHALPATVWSLGVLLYDMVCGDIPFERDQEILEAELHFPAHVSPDCCALIRRCLAPKPCSRPSLEEI
LLDPWMQSPAEEKPINSSKGSPTPLPWSLLP

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 34.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
Locus ID 18715
UniProt ID Q62070
Refseq Size 1974
Cytogenetics X 3.55 cM
Refseq ORF 933
Synonyms DXCch3; Pim-2
Summary Proto-oncogene with serine/threonine kinase activity involved in cell survival and cell proliferation. Exerts its oncogenic activity through: the regulation of MYC transcriptional activity, the regulation of cell cycle progression, the regulation of cap-dependent protein translation and through survival signaling by phosphorylation of a pro-apoptotic protein, BAD. Phosphorylation of MYC leads to an increase of MYC protein stability and thereby an increase of transcriptional activity. The stabilization of MYC exerted by PIM2 might explain partly the strong synergism between these 2 oncogenes in tumorigenesis. Regulates cap-dependent protein translation in a mammalian target of rapamycin complex 1 (mTORC1)-independent manner and in parallel to the PI3K-Akt pathway. Mediates survival signaling through phosphorylation of BAD, which induces release of the anti-apoptotic protein Bcl-X(L)/BCL2L1. Promotes cell survival in response to a variety of proliferative signals via positive regulation of the I-kappa-B kinase/NF-kappa-B cascade; this process requires phosphorylation of MAP3K8/COT. Promotes growth factor-independent proliferation by phosphorylation of cell cycle factors such as CDKN1A and CDKN1B. Involved in the positive regulation of chondrocyte survival and autophagy in the epiphyseal growth plate.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...