E2f5 (NM_007892) Mouse Recombinant Protein

CAT#: TP504971

Purified recombinant protein of Mouse E2F transcription factor 5 (E2f5), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
E2f5 Antibody - C-terminal region
    • 50 ug

CNY 4,628.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204971 protein sequence
Red=Cloning site Green=Tags(s)

MAAAEPTSSAQPTPQAQAQPPPHGAPSSQPSAALAGGSSRHEKSLGLLTTKFVSLLQEAQDGVLDLKAAA
DTLAVRQKRRIYDITNVLEGIDLIEKKSKNSIQWKGVGAGCNTKEVIDRLRCLKAEIEDLELKERELDQQ
KLWLQQSIKNVMEDSINNRFSYVTHEDICNCFHGDTLLAIQAPSGTQLEVPIPEMGQNGQKKYQINLKSH
SGPIHVLLINKESSSSKPVVFPVPPPDDLTQPSSQSSTSVTPQKSTMAAQNLPEQHVSERSQTFQQTPAA
EVSSGSISGDIIDELMSSDVFPLLRLSPTPADDYNFNLDDNEGVCDLFDVQILNY

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 36.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_031918
Locus ID 13559
UniProt ID Q61502
Refseq Size 1763
Cytogenetics 3 A1
Refseq ORF 1008
Synonyms AU024671; E2F-5
Summary Transcriptional activator that binds to E2F sites, these sites are present in the promoter of many genes whose products are involved in cell proliferation. May mediate growth factor-initiated signal transduction. It is likely involved in the early responses of resting cells to growth factor stimulation. Specifically required for multiciliate cell differentiation: together with MCIDAS and E2F5, binds and activate genes required for centriole biogenesis.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...